PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG030564.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 466aa    MW: 52004.7 Da    PI: 7.0057
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG030564.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+  ++++G g+W+++++  g+ R++k+c++rw +yl
      CCG030564.1 14 KGLWSPEEDEKLLSHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding39.21.6e-1267110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++  E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
      CCG030564.1  67 RGTFSHLEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      7999******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.4E-28664IPR009057Homeodomain-like
PROSITE profilePS5129424.811965IPR017930Myb domain
SuperFamilySSF466892.55E-2812108IPR009057Homeodomain-like
SMARTSM007179.0E-131363IPR001005SANT/Myb domain
PfamPF002495.8E-151461IPR001005SANT/Myb domain
CDDcd001672.47E-111761No hitNo description
Gene3DG3DSA:1.10.10.608.6E-2465116IPR009057Homeodomain-like
SMARTSM007172.9E-1166114IPR001005SANT/Myb domain
PROSITE profilePS5129418.70566116IPR017930Myb domain
PfamPF002491.3E-1167111IPR001005SANT/Myb domain
CDDcd001671.32E-769109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLSHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SHLEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQRG  120
IDPVTHKPLS GVEDGEDKNP AASRNQDEAS AVSNTELNLL KADHSKPLGA NLQEKRSSSI  180
SSHSNQLERE STSSFKAMND NNNNTNDHGN NNLMTPTSNK DLFLDRFAAF LHEGSTSNCQ  240
PSGFGGHFPL QQLNYASTAR LATNSIPSLW LSQTSKAFGM NCEFPSTMIP SIPPPAVTSS  300
FHSCSMGYKP SITVPPDNPS LPSFTTNSYR PWETGAPSNN SNSSTGSNGS TELQSNSSFF  360
ENTIFSWGLG DCSSTEKEAQ NHLIGSQQED IRWPEYLQNS LLMAAALQNQ NQQSLYNEIK  420
TETHLLTENP SGMWPDNQQE QEPLQNPDIC QKDMQRITAS YGYIYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9707840.0AB970784.1 Populus nigra PniMYB055 mRNA for MYB transcriptional factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011025280.10.0PREDICTED: transcription factor MYB86
TrEMBLB9GRW70.0B9GRW7_POPTR; Uncharacterized protein
STRINGPOPTR_0002s18700.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.13e-90myb domain protein 61